Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P35625 |
| Gene Names | TIMP3 |
| Alternative Names | Protein MIG-5Tissue inhibitor of metalloproteinases 3 ;TIMP-3 |
| Expression Region | Partial(30-208aa ) |
| Molecular Weight | 24.8 kDa |
| Protein Sequence | HPQDAFCNSDIVIRAKVVGKKLVKEGPFGTLVYTIKQMKMYRGFTKMPHVQYIHTEASESLCGLKLEVNKYQYLLTGRVYDGKMYTGLCNFVERWDQLTLSQRKGLNYRYHLGCNCKIKSCYYLPCFVTSKNECLWTDMLSNFGYPGYQSKHYACIRQKGGYCSWYRGWAPPDKSIINA |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Complexes with metalloproteinases (such as collagenases) and irreversibly inactivates th by binding to their catalytic zinc cofactor. May form part of a tissue-specific acute response to rodeling stimuli. Known to act on MMP-1, MMP-2, MMP-3, MMP-7, MMP-9, MMP-13, MMP-14 and MMP-15. |
| Involvement in Disease | Sorsby fundus dystrophy (SFD) |
| Subcellular Location | Secreted, extracellular space, extracellular matrix |
| Protein Families | Protease inhibitor I35 (TIMP) family |
| Tissue Specificity | TIMP3 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |