Specification
Organism | Homo sapiens (Human) |
Expression Host | Mammalian cell |
Tag Info | C-terminal 6xHis-myc-tagged |
Purity | Greater than 85% by SDS-PAGE |
Uniprot ID | P16035 |
Gene Names | TIMP2 |
Alternative Names | CSC-21KTissue inhibitor of metalloproteinases 2;TIMP-2 |
Expression Region | Full Length of Mature Protein(27-220aa ) |
Molecular Weight | 25.1 kDa |
Protein Sequence | CSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP |
Form | Liquid or Lyophilization |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
Relevance | Complexes with metalloproteinases (such as collagenases) and irreversibly inactivates th by binding to their catalytic zinc cofactor. Known to act on MMP-1, MMP-2, MMP-3, MMP-7, MMP-8, MMP-9, MMP-10, MMP-13, MMP-14, MMP-15, MMP-16 and MMP-19. |
Involvement in Disease | |
Subcellular Location | |
Protein Families | |
Tissue Specificity | TIMP2 |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |