Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-SUMO-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q15648 |
| Gene Names | MED1 |
| Alternative Names | Activator-recruited cofactor 205KDA component Short name: ARC205 Mediator complex subunit 1 Peroxisome proliferator-activated receptor-binding protein Short name: PBP Short name: PPAR-binding protein Thyroid hormone receptor-associated protein complex 220KDA component Short name: Trap220 Thyroid receptor-interacting protein 2 Short name: TR-interacting protein 2 Short name: TRIP-2 Vitamin D receptor-interacting protein complex component DRIP205 p53 regulatory protein RB18A |
| Expression Region | Partial(878-1031aa ) |
| Molecular Weight | 32.2 kDa |
| Protein Sequence | FGEEYFDESSQSGDNDDFKGFASQALNTLGVPMLGGDNGETKFKGNNQADTVDFSIISVAGKALAPADLMEHHSGSQGPLLTTGDLGKEKTQKRVKEGNGTSNSTLSGPGLDSKPGKRSRTPSNDGKSKDKPPKRKKADTEGKSPSHSSSNRPF |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (PubMed:10406464, PubMed:11867769, PubMed:12037571, PubMed:12218053, PubMed:12556447, PubMed:14636573, PubMed:15340084, PubMed:15471764, PubMed:15989967, PubMed:16574658, PubMed:9653119). Acts as a coactivator for GATA1-mediated transcriptional activation during erythroid differentiation of K562 erythroleukemia cells (PubMed:24245781). |
| Involvement in Disease | |
| Subcellular Location | Nucleus |
| Protein Families | Mediator complex subunit 1 family |
| Tissue Specificity | MED1 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |