Recombinant Human MARVELD1 protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens MARVEL domain containing 1 (MARVELD1) (NM_031484).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q9BSK0
Entry Name MALD1_HUMAN
Gene Names MARVELD1 MRVLDC1
Alternative Gene Names MRVLDC1
Alternative Protein Names MARVEL domain-containing protein 1
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 173
Molecular Weight(Da) 18914
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MLPPPPRQPPPQARAARGAVRLQRPFLRSPLGVLRLLQLLAGAAFWITIATSKYQGPVHFALFVSVLFWLLTLGLYFLTLLGKHELVPVLGSRWLMVNVAHDVLAAALYGAATGIMSDQMQRHSYCNLKDYPLPCAYHAFLAAAVCGGVCHGLYLLSALYGCGRRCQGKQEVA
Background
Function FUNCTION: Microtubule-associated protein that exhibits cell cycle-dependent localization and can inhibit cell proliferation and migration. {ECO:0000250}.
Pathway
Protein Families
Tissue Specificity Widely expressed in normal tissues. Down-regulated in multiple primary tumors. {ECO:0000269|PubMed:19364627}.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8291795

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human MARVELD1 protein
Copyright © 2021-present Echo Biosystems. All rights reserved.