Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-GST-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q8NHS3 |
| Gene Names | MFSD8 |
| Alternative Names | Ceroid-lipofuscinosis neuronal protein 7 |
| Expression Region | Partial(1-40aa ) |
| Molecular Weight | 34.8 kDa |
| Protein Sequence | MAGLRNESEQEPLLGDTPGSREWDILETEEHYKSRWRSIR |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | May be a carrier that transport small solutes by using chemiosmotic ion gradients |
| Involvement in Disease | Ceroid lipofuscinosis, neuronal, 7 (CLN7); Macular dystrophy with central cone involvement (CCMD) |
| Subcellular Location | Lysosome membrane, Multi-pass membrane protein |
| Protein Families | Major facilitator superfamily |
| Tissue Specificity | MFSD8 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |