Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens MAGE family member A5 (MAGEA5) (NM_021049). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | P43359 |
| Entry Name | MAGA5_HUMAN |
| Gene Names | MAGEA5P MAGE5 MAGEA5 |
| Alternative Gene Names | MAGE5 MAGEA5 |
| Alternative Protein Names | Putative melanoma-associated antigen 5P (Cancer/testis antigen 1.5) (CT1.5) (MAGE family member A5 pseudogene) (MAGE-5 antigen) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 124 |
| Molecular Weight(Da) | 13016 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MSLEQKSQHCKPEEGLDTQEEALGLVGVQAATTEEQEAVSSSSPLVPGTLGEVPAAGSPGPLKSPQGASAIPTAIDFTLWRQSIKGSSNQEEEGPSTSPDPESVFRAALSKKVADLIHFLLLKY |
Background
| Function | FUNCTION: May negatively regulates apoptosis. {ECO:0000269|PubMed:17942928}. |
| Pathway | |
| Protein Families | |
| Tissue Specificity | Expressed in many tumors of several types, such as melanoma, head and neck squamous cell carcinoma, lung carcinoma and breast carcinoma, but not in normal tissues except for testes. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |