Specification
| Organism | Homo sapiens (Human) |
| Expression Host | Mammalian cell |
| Tag Info | C-terminal hFc-tagged |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprot ID | P14174 |
| Uniprot Entry Name | |
| Gene Names | MIF |
| Alternative Names | (MIF)(Glycosylation-inhibiting factor)(GIF)(L-dopachrome isomerase)(L-dopachrome tautomerase)(Phenylpyruvate tautomerase) |
| Expression Region | Full Length of Mature Protein (2-115aa) |
| Molecular Weight | 41.3 kDa |
| Endotoxin | Less than 1.0 EU/ug as determined by LAL method. |
| Sequence | PMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA |
| Product Form | Lyophilized powder (Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4) |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Background
| Relevance | Pro-inflammatory cytokine. Involved in the innate immune response to bacterial pathogens. The expression of MIF at sites of inflammation suggests a role as mediator in regulating the function of macrophages in host defense. Counteracts the anti-inflammatory activity of glucocorticoids. Has phenylpyruvate tautomerase and dopachrome tautomerase activity (in vitro), but the physiological substrate is not known. It is not clear whether the tautomerase activity has any physiological relevance, and whether it is important for cytokine activity. |
| Function | |
| Involvement in disease | |
| Subcellular Location | |
| Protein Families | |
| Tissue Specificity | |
| Pathway |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) | ![]() |
