Specification
| Organism | Homo sapiens (Human) |
| Expression Host | Mammalian cell |
| Tag Info | C-terminal 6xHis-tagged |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Uniprot ID | P09603 |
| Uniprot Entry Name | |
| Gene Names | CSF1 |
| Alternative Names | Macrophage Colony-Stimulating Factor 1; CSF-1; M-CSF; MCSF; Lanimostim; CSF1 |
| Expression Region | Partial (33-255aa) |
| Molecular Weight | 26.17 kDa |
| Endotoxin | Less than 1.0 EU/µg as determined by LAL method. |
| Sequence | EEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQDVVTKPDCNCLYPKAIPSSDPASVSPHQPLAPSMAPVAGLTWEDSEGTEGSSLLPGEQPLHTVDPGSAKQRPPR |
| Product Form | Lyophilized powder (Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.2) |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Macrophage Colony-Stimulating Factors (m-csf) are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and themonocytes-macrophages. CSF-1 promotes the release of proinflammatory chemokines, and thereby plays an important role in innate immunity and in inflammatory processes. It also plays an important role in the regulation of osteoclast proliferation and differentiation, the regulation of bone resorption, and is required for normal bone development. CSF-1 is required for normal male and female fertility and promotes reorganization of the actin cytoskeleton, regulates formation of membrane ruffles, cell adhesion and cell migration. it also plays a role in lipoprotein clearance. |
| Function | Cytokine that plays an essential role in the regulation of survival, proliferation and differentiation of hematopoietic precursor cells, especially mononuclear phagocytes, such as macrophages and monocytes. Promotes the release of proinflammatory chemokines, and thereby plays an important role in innate immunity and in inflammatory processes. Plays an important role in the regulation of osteoclast proliferation and differentiation, the regulation of bone resorption, and is required for normal bone development. Required for normal male and female fertility. Promotes reorganization of the actin cytoskeleton, regulates formation of membrane ruffles, cell adhesion and cell migration. Plays a role in lipoprotein clearance. |
| Involvement in disease | Aberrant expression of CSF1 or CSF1R can promote cancer cell proliferation, invasion and formation of metastases. Overexpression of CSF1 or CSF1R is observed in a significant percentage of breast, ovarian, prostate, and endometrial cancers.; DISEASE: Note=Aberrant expression of CSF1 or CSF1R may play a role in inflammatory diseases, such as rheumatoid arthritis, glomerulonephritis, atherosclerosis, and allograft rejection. |
| Subcellular Location | Cell membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Processed macrophage colony-stimulating factor 1: Secreted, extracellular space |
| Protein Families | |
| Tissue Specificity | |
| Pathway | MAPKsignalingpathway |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |