Recombinant Human LZIC protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens leucine zipper and CTNNBIP1 domain containing (LZIC), transcript variant 1 (NM_032368).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q8WZA0
Entry Name LZIC_HUMAN
Gene Names LZIC
Alternative Gene Names
Alternative Protein Names Protein LZIC (Leucine zipper and CTNNBIP1 domain-containing protein) (Leucine zipper and ICAT homologous domain-containing protein)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 190
Molecular Weight(Da) 21495
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MASRGKTETSKLKQNLEEQLDRLMQQLQDLEECREELDTDEYEETKKETLEQLSEFNDSLKKIMSGNMTLVDELSGMQLAIQAAISQAFKTPEVIRLFAKKQPGQLRTRLAEMDRDLMVGKLERDLYTQQKVEILTALRKLGEKLTADDEAFLSANAGAILSQFEKVSTDLGSGDKILALASFEVEKTKK
Background
Function
Pathway
Protein Families CTNNBIP1 family
Tissue Specificity Ubiquitously expressed, with highest levels in kidney. Up-regulated in several cases of gastric cancers. {ECO:0000269|PubMed:11712074}.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$389.00
In stock
SKU
EB-EPE8496005

Recombinant Human LZIC protein

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human LZIC protein
Copyright © 2021-present Echo Biosystems. All rights reserved.