Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-SUMO-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q6UWQ5 |
| Gene Names | LYZL1 |
| Alternative Names | (1; 4-beta-N-acetylmuramidase); LYZ; alfa-lacalbumin, C-type lysozyme; bA534G20.1; EC 3.2.1.17; KAAG648; LYC2; Lysozyme like 1; Lysozyme-like protein 1; LYZL1; LYZL1_HUMAN; MGC33408; muramidase; OTTHUMP00000019386; PRO1278; Sperm acrosome membrane associated protein 3 |
| Expression Region | Full Length of Isoform 2(1-194aa ) |
| Molecular Weight | 37.6 kDa |
| Protein Sequence | MQDAPLSCLSPTKWSSVSSADSTEKSASGAGTRNLPFQFCLRQALRMKAAGILTLIGCLVTGAESKIYTRCKLAKIFSRAGLDNYWGFSLGNWICMAYYESGYNTTAQTVLDDGSIDYGIFQINSFAWCRRGKLKENNHCHVACSALITDDLTDAIICARKIVKETQGMNYWQGWKKHCEGRDLSEWKKGCEVS |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | |
| Involvement in Disease | |
| Subcellular Location | Secreted |
| Protein Families | Glycosyl hydrolase 22 family |
| Tissue Specificity | LYZL1 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |