Recombinant Human LYRM4 protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens LYR motif containing 4 (LYRM4), transcript variant 1 (NM_020408).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q9HD34
Entry Name LYRM4_HUMAN
Gene Names LYRM4 C6orf149 ISD11 CGI-203
Alternative Gene Names C6orf149 ISD11
Alternative Protein Names LYR motif-containing protein 4
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 91
Molecular Weight(Da) 10758
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MAASSRAQVLSLYRAMLRESKRFSAYNYRTYAVRRIRDAFRENKNVKDPVEIQTLVNKAKRDLGVIRRQVHIGQLYSTDKLIIENRDMPRT
Background
Function FUNCTION: Required for nuclear and mitochondrial iron-sulfur protein biosynthesis. {ECO:0000269|PubMed:17331979, ECO:0000269|PubMed:19454487}.
Pathway Cofactor biosynthesis; iron-sulfur cluster biosynthesis.
Protein Families Complex I LYR family
Tissue Specificity Reduced mRNA levels in Friedreich ataxia patients. {ECO:0000269|PubMed:17331979}.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8047356

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human LYRM4 protein
Copyright © 2026-present Echo Bio. All rights reserved.