Recombinant Human Lymphocyte antigen 96(LY96)

Specification
Organism Homo sapiens (Human)
Expression Host Baculovirus
Tag Info N-terminal 10xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID Q9Y6Y9
Gene Names LY96
Alternative Names ESOP-1 (Protein MD-2) (ESOP1) (MD2)
Expression Region Full Length of Mature Protein(19-160aa )
Molecular Weight 17.5
Protein Sequence QKQYWVCNSSDASISYTYCDKMQYPISINVNPCIELKRSKGLLHIFYIPRRDLKQLYFNLYITVNTMNLPKRKEVICRGSDDDYSFCRALKGETVNTTISFSFKGIKFSKGKYKCVVEAISGSPEEMLFCLEFVILHQPNSN
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Binds bacterial lipopolysaccharide . Cooperates with TLR4 in the innate immune response to bacterial lipopolysaccharide , and with TLR2 in the response to cell wall components from Gram-positive and Gram-negative bacteria . Enhances TLR4-dependent activation of NF-kappa-B . Cells expressing both LY96 and TLR4, but not TLR4 alone, respond to LPS .
Involvement in Disease
Subcellular Location
Protein Families
Tissue Specificity LY96
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$475.00
In stock
SKU
EB-PBM13379

Recombinant Human Lymphocyte antigen 96(LY96)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human Lymphocyte antigen 96(LY96)
Copyright © 2021-present Echo Biosystems. All rights reserved.