Recombinant Human LYG2 protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens lysozyme g2 (LYG2) (NM_175735).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q86SG7
Entry Name LYG2_HUMAN
Gene Names LYG2 LYGH
Alternative Gene Names LYGH
Alternative Protein Names Lysozyme g-like protein 2 (EC 3.2.1.-)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 212
Molecular Weight(Da) 23498
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MLSSVVFWGLIALIGTSRGSYPFSHSMKPHLHPRLYHGCYGDIMTMKTSGATCDANSVMNCGIRGSEMFAEMDLRAIKPYQTLIKEVGQRHCVDPAVIAAIISRESHGGSVLQDGWDHRGLKFGLMQLDKQTYHPVGAWDSKEHLSQATGILTERIKAIQKKFPTWSVAQHLKGGLSAFKSGIEAIATPSDIDNDFVNDIIARAKFYKRQSF
Background
Function FUNCTION: May act as a potent antibacterial protein that may play a role in the innate immunity. {ECO:0000269|PubMed:21093056}.
Pathway
Protein Families Glycosyl hydrolase 23 family
Tissue Specificity Strong expression detected in the eye and weak expression in the testis. No expression is observed in any other tissues. {ECO:0000269|PubMed:21093056}.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$389.00
In stock
SKU
EB-EPE8447485

Recombinant Human LYG2 protein

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human LYG2 protein
Copyright © 2021-present Echo Biosystems. All rights reserved.