Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | O95232 |
| Gene Names | LUC7L3 |
| Alternative Names | Cisplatin resistance-associated-overexpressed protein;Luc7AOkadaic acid-inducible phosphoprotein OA48-18cAMP regulatory element-associated protein 1 ;CRE-associated protein 1 ;CREAP-1 |
| Expression Region | Partial(1-79aa ) |
| Molecular Weight | 13.3 kDa |
| Protein Sequence | MISAAQLLDELMGRDRNLAPDEKRSNVRWDHESVCKYYLCGFCPAELFTNTRSDLGPCEKIHDENLRKQYEKSSRFMKV |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Binds cAMP regulatory elent DNA sequence. May play a role in RNA splicing. |
| Involvement in Disease | |
| Subcellular Location | Nucleus speckle |
| Protein Families | Luc7 family |
| Tissue Specificity | LUC7L3 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |