Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens leukocyte specific transcript 1 (LST1), transcript variant 4 (NM_205839). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | O00453 |
| Entry Name | LST1_HUMAN |
| Gene Names | LST1 B144 |
| Alternative Gene Names | B144 |
| Alternative Protein Names | Leukocyte-specific transcript 1 protein (Protein B144) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 97 |
| Molecular Weight(Da) | 10792 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MLSRNDDICIYGGLGLGGLLLLAVVLLSACLCWLHRRVKRLERSWAQGSSEQELHYASLQRLPVPSSEGPDLRGRDKRGTKEDPRADYACIAENKPT |
Background
| Function | FUNCTION: Possible role in modulating immune responses. Induces morphological changes including production of filopodia and microspikes when overexpressed in a variety of cell types and may be involved in dendritic cell maturation. Isoform 1 and isoform 2 have an inhibitory effect on lymphocyte proliferation. {ECO:0000269|PubMed:10706707, ECO:0000269|PubMed:11478849}. |
| Pathway | |
| Protein Families | LST1 family |
| Tissue Specificity | Expressed in lung, tonsil, thymus, placenta, kidney, fetal spleen, fetal liver and brain. {ECO:0000269|PubMed:7590964, ECO:0000269|PubMed:9367684}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |