Recombinant Human Low molecular weight phosphotyrosine protein phosphatase(ACP1)

Specification
Organism Homo sapiens (Human)
Expression Host E.coli
Tag Info Tag-Free
Purity Greater than 85% by SDS-PAGE
Uniprot ID P24666
Gene Names ACP1
Alternative Names Adipocyte acid phosphatase Low molecular weight cytosolic acid phosphatase (EC:3.1.3.2) Red cell acid phosphatase 1
Expression Region Full Length(1-158aa )
Molecular Weight 18 kDa
Protein Sequence MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRGQSCMKRHGIPMSHVARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Acts on tyrosine phosphorylated proteins, low-MW aryl phosphates and natural and synthetic acyl phosphates. Isoform 3 does not possess phosphatase activity.
Involvement in Disease
Subcellular Location Cytoplasm
Protein Families Low molecular weight phosphotyrosine protein phosphatase family
Tissue Specificity ACP1
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$351.00
In stock
SKU
EB-PEUe111886

Recombinant Human Low molecular weight phosphotyrosine protein phosphatase(ACP1)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human Low molecular weight phosphotyrosine protein phosphatase(ACP1)
Copyright © 2021-present Echo Biosystems. All rights reserved.