Specification
| Organism | Homo sapiens (Human) |
| Expression Host | Yeast |
| Tag Info | N-terminal 6xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P98164 |
| Gene Names | LRP2 |
| Alternative Names | Glycoprotein 330 ;gp330Megalin |
| Expression Region | partial(1186-1389aa ) |
| Molecular Weight | 24.2 kDa |
| Protein Sequence | NCTASQFKCASGDKCIGVTNRCDGVFDCSDNSDEAGCPTRPPGMCHSDEFQCQEDGICIPNFWECDGHPDCLYGSDEHNACVPKTCPSSYFHCDNGNCIHRAWLCDRDNDCGDMSDEKDCPTQPFRCPSWQWQCLGHNICVNLSVVCDGIFDCPNGTDESPLCNGNSCSDFNGGCTHECVQEPFGAKCLCPLGFLLANDSKTCE |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Acts together with cubilin to mediate HDL endocytosis . May participate in regulation of parathyroid-hormone and para-thyroid-hormone-related protein release. |
| Involvement in Disease | Donnai-Barrow syndrome (DBS) |
| Subcellular Location | Apical cell membrane, Single-pass type I membrane protein, Endosome lumen, Membrane, coated pit, Cell projection, dendrite, Cell projection, axon |
| Protein Families | LDLR family |
| Tissue Specificity | LRP2 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |