Specification
Gene Names | FCGR3A |
Alternative Names | CD16A |
Organism | Homo sapiens (Human) |
Expression Host | Mammalian cell |
Molecular Weight | 90.6 kDa |
Expression Region | Partial(17-208aa(F176V) ) |
Expression Region | C-terminal 10xHis-HSA-tagged(Partial ) |
Purity | Greater than 95% as determined by SDS-PAGE. |
Endotoxin | Less than 1.0 EU/ug as determined by LAL method. |
Biological Activity | Loaded Anti-Human CD16a Antibody on 96-Flat plate, can bind Human CD16a(F176V), with an affinity constant of 12 nM as determined in BLI assay (Gator Prime). |
Form | Lyophilized powder |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Storage | Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. |
Protein Sequence | GMRTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAVSTISSFFPPGYQ |
Background
Research Areas | Immunology |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |