Specification
| Organism | Homo sapiens (Human) |
| Expression Host | Mammalian cell |
| Tag Info | N-terminal 6xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P06734 |
| Gene Names | FCER2 |
| Alternative Names | BLAST-2 (C-type lectin domain family 4 member J) (Fc-epsilon-RII) (Immunoglobulin E-binding factor) (Lymphocyte IgE receptor) |
| Expression Region | Partial(48-321aa ) |
| Molecular Weight | 33.2 |
| Protein Sequence | DTTQSLKQLEERAARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAESMGPDSRPDPDGRLPTPSAPLHS |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Low-affinity receptor for immunoglobulin E and CR2/CD21. Has essential roles in the regulation of IgE production and in the differentiation of B-cells . |
| Involvement in Disease | |
| Subcellular Location | |
| Protein Families | |
| Tissue Specificity | FCER2 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |