Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Protein Tag | N-terminal 6xHis-tagged |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Endotoxin Level | Not test. |
| Biological Activity | |
| Uniprot ID | P06734 |
| Gene Names | FCER2 |
| Alternative Names | (BLAST-2)(C-type lectin domain family 4 member J)(Fc-epsilon-RII)(Immunoglobulin E-binding factor)(Lymphocyte IgE receptor)(CD antigen CD23) |
| Expression Region | 48-248aa |
| Product Form | Liquid or Lyophilized powder |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.36 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-128℃. |
| Protein Length | Partial |
| Molecular Weight | 27.3 kDa |
| Protein Sequence | DTTQSLKQLEERAARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPG |
Background
| Research Areas | Immunology |
| Relevance | Low-affinity receptor for immunoglobulin E (IgE) and CR2/CD21. Has essential roles in the regulation of IgE production and in the differentiation of B-cells (it is a B-cell-specific antigen). |
| Function | |
| Reference | Mutations in the autoregulatory domain of beta-tubulin 4a cause hereditary dystonia.Hersheson J., Mencacci N.E., Davis M., Macdonald N., Trabzuni D., Ryten M., Pittman A., Paudel R., Kara E., Fawcett K., Plagnol V., Bhatia K.P., Medlar A.J., Stanescu H.C., Hardy J., Kleta R., Wood N.W., Houlden H.Ann. Neurol. 73:546-553(2013) |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |