Recombinant Human Low affinity immunoglobulin epsilon Fc receptor(FCER2),partial

Specification
Organism Homo sapiens (Human)
Expression Host E.coli
Protein Tag N-terminal GST-tagged
Purity Greater than 85% as determined by SDS-PAGE.
Endotoxin Level Not test.
Biological Activity
Uniprot ID P06734
Gene Names FCER2
Alternative Names (BLAST-2)(C-type lectin domain family 4 member J)(Fc-epsilon-RII)(Immunoglobulin E-binding factor)(Lymphocyte IgE receptor)(CD antigen CD23)
Expression Region 48-248aa
Product Form Liquid or Lyophilized powder
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.2 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-94℃.
Protein Length Partial
Molecular Weight 49.9 kDa
Protein Sequence DTTQSLKQLEERAARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPG
Background
Research Areas Immunology
Relevance Low-affinity receptor for immunoglobulin E (IgE) and CR2/CD21. Has essential roles in the regulation of IgE production and in the differentiation of B-cells (it is a B-cell-specific antigen).
Function
Reference "Structural changes in the lectin domain of CD23, the low-affinity IgE receptor, upon calcium binding." Wurzburg B.A., Tarchevskaya S.S., Jardetzky T.S. Structure 14:1049-1058(2006)
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$218.00
In stock
SKU
EB-N231015

Protein expressed from mulitple host is available with various size. Please inquiry us if you need any customized needs.

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human Low affinity immunoglobulin epsilon Fc receptor(FCER2),partial
Copyright © 2021-present Echo Biosystems. All rights reserved.