Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Protein Tag | N-terminal GST-tagged |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Endotoxin Level | Not test. |
| Biological Activity | |
| Uniprot ID | P06734 |
| Gene Names | FCER2 |
| Alternative Names | (BLAST-2)(C-type lectin domain family 4 member J)(Fc-epsilon-RII)(Immunoglobulin E-binding factor)(Lymphocyte IgE receptor)(CD antigen CD23) |
| Expression Region | 48-248aa |
| Product Form | Liquid or Lyophilized powder |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.2 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-94℃. |
| Protein Length | Partial |
| Molecular Weight | 49.9 kDa |
| Protein Sequence | DTTQSLKQLEERAARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPG |
Background
| Research Areas | Immunology |
| Relevance | Low-affinity receptor for immunoglobulin E (IgE) and CR2/CD21. Has essential roles in the regulation of IgE production and in the differentiation of B-cells (it is a B-cell-specific antigen). |
| Function | |
| Reference | "Structural changes in the lectin domain of CD23, the low-affinity IgE receptor, upon calcium binding." Wurzburg B.A., Tarchevskaya S.S., Jardetzky T.S. Structure 14:1049-1058(2006) |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) | ![]() |
