Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal GST-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q99732 |
| Gene Names | LITAF |
| Alternative Names | Small integral membrane protein of lysosome/late endosome p53-induced gene 7 protein |
| Expression Region | Full Length(1-161aa ) |
| Molecular Weight | 44.1 kDa |
| Protein Sequence | MSVPGPYQAATGPSSAPSAPPSYEETVAVNSYYPTPPAPMPGPTTGLVTGPDGKGMNPPSYYTQPAPIPNNNPITVQTVYVQHPITFLDRPIQMCCPSCNKMIVSQLSYNAGALTWLSCGSLCLLGCIAGCCFIPFCVDALQDVDHYCPNCRALLGTYKRL |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Probable role in regulating transcription of specific genes. May regulate through NFKB1 the expression of the CCL2/MCP-1 chemokine. May play a role in tumor necrosis factor alpha (TNF-alpha) gene expression. |
| Involvement in Disease | Charcot-Marie-Tooth disease 1C (CMT1C) |
| Subcellular Location | Cytoplasm, Nucleus, Lysosome membrane, Peripheral membrane protein, Cytoplasmic side, Early endosome membrane, Late endosome membrane, Endosome membrane, Peripheral membrane protein, Cytoplasmic side, Cell membrane, Peripheral membrane protein, Cytoplasmic side, Golgi apparatus membrane |
| Protein Families | CDIP1/LITAF family |
| Tissue Specificity | LITAF |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |