Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens galectin 7 (LGALS7) (NM_002307). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | P47929 |
| Entry Name | LEG7_HUMAN |
| Gene Names | LGALS7 PIG1; LGALS7B |
| Alternative Gene Names | PIG1; |
| Alternative Protein Names | Galectin-7 (Gal-7) (HKL-14) (PI7) (p53-induced gene 1 protein) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 136 |
| Molecular Weight(Da) | 15075 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MSNVPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSVRIF |
Background
| Function | FUNCTION: Could be involved in cell-cell and/or cell-matrix interactions necessary for normal growth control. Pro-apoptotic protein that functions intracellularly upstream of JNK activation and cytochrome c release. {ECO:0000269|PubMed:11706006}. |
| Pathway | |
| Protein Families | |
| Tissue Specificity | Mainly expressed in stratified squamous epithelium. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |