Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens galectin 13 (LGALS13) (NM_013268). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | Q9UHV8 |
| Entry Name | PP13_HUMAN |
| Gene Names | LGALS13 PLAC8 |
| Alternative Gene Names | PLAC8 |
| Alternative Protein Names | Galactoside-binding soluble lectin 13 (Galectin-13) (Gal-13) (Placental tissue protein 13) (PP13) (Placental protein 13) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 139 |
| Molecular Weight(Da) | 16119 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MSSLPVPYKLPVSLSVGSCVIIKGTPIHSFINDPQLQVDFYTDMDEDSDIAFRFRVHFGNHVVMNRREFGIWMLEETTDYVPFEDGKQFELCIYVHYNEYEIKVNGIRIYGFVHRIPPSFVKMVQVSRDISLTSVCVCN |
Background
| Function | FUNCTION: Binds beta-galactoside and lactose. Strong inducer of T-cell apoptosis (PubMed:10527825, PubMed:19497882). Has hemagglutinating activity towards chicken erythrocytes (PubMed:29343868). {ECO:0000269|PubMed:10527825, ECO:0000269|PubMed:19497882, ECO:0000269|PubMed:29343868}. |
| Pathway | |
| Protein Families | |
| Tissue Specificity | Detected in adult and fetal spleen, fetal kidney, adult urinary bladder and placenta. Placental expression originates predominantly from the syncytiotrophoblast. {ECO:0000269|PubMed:10527825, ECO:0000269|PubMed:19497882}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |