Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | O00453 |
| Gene Names | LST1 |
| Alternative Names | Protein B144 |
| Expression Region | Full Length of Isoform 10(1-66aa ) |
| Molecular Weight | 11.5 kDa |
| Protein Sequence | MLSRNDVKRLERSWAQGSSEQELHYASLQRLPVPSSEGPDLRGRDKRGTKEDPRADYACIAENKPT |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Possible role in modulating immune responses. Induces morphological changes including production of filopodia and microspikes when overexpressed in a variety of cell types and may be involved in dendritic cell maturation. Isoform 1 and isoform 2 have an inhibitory effect on lymphocyte proliferation. |
| Involvement in Disease | |
| Subcellular Location | Membrane, Single-pass membrane protein, Golgi apparatus membrane, Single-pass membrane protein, Endomembrane system, Single-pass membrane protein |
| Protein Families | LST1 family |
| Tissue Specificity | LST1 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |