Specification
| Organism | Homo sapiens (Human) |
| Expression Host | Yeast |
| Tag Info | N-terminal 6xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | A6NI73 |
| Gene Names | LILRA5 |
| Alternative Names | CD85 antigen-like family member FImmunoglobulin-like transcript 11 ;ILT-11Leukocyte immunoglobulin-like receptor 9 ;LIR-9; CD85f |
| Expression Region | Extracellular Domain(42-268aa ) |
| Molecular Weight | 27.2 kDa |
| Protein Sequence | GNLSKATLWAEPGSVISRGNSVTIRCQGTLEAQEYRLVKEGSPEPWDTQNPLEPKNKARFSIPSMTEHHAGRYRCYYYSPAGWSEPSDPLELVVTGFYNKPTLSALPSPVVTSGENVTLQCGSRLRFDRFILTEEGDHKLSWTLDSQLTPSGQFQALFPVGPVTPSHRWMLRCYGSRRHILQVWSEPSDLLEIPVSGAADNLSPSQNKSDSGTASHLQDYAVENLIR |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | May play a role in triggering innate immune responses. Does not se to play a role for any class I MHC antigen recognition. |
| Involvement in Disease | |
| Subcellular Location | Cell membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Isoform 3: Secreted |
| Protein Families | |
| Tissue Specificity | LILRA5 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) | ![]() |
