Specification
Organism | Homo sapiens (Human) |
Expression Host | Mammalian cell |
Tag Info | N-terminal 6xHis-tagged |
Purity | Greater than 85% by SDS-PAGE |
Uniprot ID | A6NI73 |
Gene Names | LILRA5 |
Alternative Names | CD85 antigen-like family member F Immunoglobulin-like transcript 11 Short name: ILT-11 Leukocyte immunoglobulin-like receptor 9 Short name: LIR-9 CD_antigen: CD85f |
Expression Region | Partial(42-268aa ) |
Molecular Weight | 29.2 kDa |
Protein Sequence | GNLSKATLWAEPGSVISRGNSVTIRCQGTLEAQEYRLVKEGSPEPWDTQNPLEPKNKARFSIPSMTEHHAGRYRCYYYSPAGWSEPSDPLELVVTGFYNKPTLSALPSPVVTSGENVTLQCGSRLRFDRFILTEEGDHKLSWTLDSQLTPSGQFQALFPVGPVTPSHRWMLRCYGSRRHILQVWSEPSDLLEIPVSGAADNLSPSQNKSDSGTASHLQDYAVENLIR |
Form | Liquid or Lyophilization |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
Relevance | May play a role in triggering innate immune responses. Does not seem to play a role for any class I MHC antigen recognition. |
Involvement in Disease | |
Subcellular Location | Cell membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Isoform 3: Secreted |
Protein Families | |
Tissue Specificity | LILRA5 |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |