Specification
Organism | Homo sapiens (Human) |
Expression Host | E.coli |
Tag Info | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
Purity | Greater than 85% by SDS-PAGE |
Uniprot ID | O00292 |
Gene Names | LEFTY2 |
Alternative Names | Endometrial bleeding-associated factor (Left-right determination factor A) (Protein lefty-2) (Protein lefty-A) (Transforming growth factor beta-4) (TGF-beta-4) (EBAF) (LEFTA) (LEFTYA) (TGFB4) |
Expression Region | Full Length of Mature Protein(77-366aa ) |
Molecular Weight | 39.8 kDa |
Protein Sequence | RFSQSFREVAGRFLASEASTHLLVFGMEQRLPPNSELVQAVLRLFQEPVPKAALHRHGRLSPRSAQARVTVEWLRVRDDGSNRTSLIDSRLVSVHESGWKAFDVTEAVNFWQQLSRPRQPLLLQVSVQREHLGPLASGAHKLVRFASQGAPAGLGEPQLELHTLDLRDYGAQGDCDPEAPMTEGTRCCRQEMYIDLQGMKWAKNWVLEPPGFLAYECVGTCQQPPEALAFNWPFLGPRQCIASETASLPMIVSIKEGGRTRPQVVSLPNMRVQKCSCASDGALVPRRLQP |
Form | Liquid or Lyophilization |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
Relevance | Required for left-right asymmetry determination of organ systems in mammals. May play a role in endometrial bleeding. |
Involvement in Disease | |
Subcellular Location | |
Protein Families | |
Tissue Specificity | LEFTY2 |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |