Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens LBH regulator of WNT signaling pathway (LBH) (NM_030915). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | Q53QV2 |
| Entry Name | LBH_HUMAN |
| Gene Names | LBH |
| Alternative Gene Names | |
| Alternative Protein Names | Protein LBH (hLBH) (Limb bud and heart development protein homolog) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 105 |
| Molecular Weight(Da) | 12217 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MSIYFPIHCPDYLRSAKMTEVMMNTQPMEEIGLSPRKDGLSYQIFPDPSDFDRCCKLKDRLPSIVVEPTEGEVESGELRWPPEEFLVQEDEQDNCEETAKENKEQ |
Background
| Function | FUNCTION: Transcriptional activator which may act in mitogen-activated protein kinase signaling pathway. {ECO:0000269|PubMed:17390236}. |
| Pathway | |
| Protein Families | LBH family |
| Tissue Specificity | Highly expressed in heart, and expressed at low levels in placenta, lung, skeletal muscle, kidney and liver. {ECO:0000269|PubMed:17390236}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |