Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | Tag-Free |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P00338 |
| Gene Names | LDHA |
| Alternative Names | Cell proliferation-inducing gene 19 protein LDH muscle subunit |
| Expression Region | Partial(5-323aa ) |
| Molecular Weight | 35.1 kDa |
| Protein Sequence | KDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTL |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | |
| Involvement in Disease | Glycogen storage disease 11 (GSD11) |
| Subcellular Location | Cytoplasm |
| Protein Families | LDH/MDH superfamily, LDH family |
| Tissue Specificity | LDHA |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |