Recombinant Human KLF7 protein

Specification
Description Recombinant protein from the full-length sequence of homo sapiens Kruppel-like factor 7 (ubiquitous) (KLF7), transcript variant 1 (NM_003709).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID O75840
Entry Name KLF7_HUMAN
Gene Names KLF7 UKLF
Alternative Gene Names UKLF
Alternative Protein Names Krueppel-like factor 7 (Ubiquitous krueppel-like factor)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 302
Molecular Weight(Da) 33362
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MDVLASYSIFQELQLVHDTGYFSALPSLEETWQQTCLELERYLQTEPRRISETFGEDLDCFLHASPPPCIEESFRRLDPLLLPVEAAICEKSSAVDILLSRDKLLSETCLSLQPASSSLDSYTAVNQAQLNAVTSLTPPSSPELSRHLVKTSQTLSAVDGTVTLKLVAKKAALSSVKVGGVATAAAAVTAAGAVKSGQSDSDQGGLGAEACPENKKRVHRCQFNGCRKVYTKSSHLKAHQRTHTGEKPYKCSWEGCEWRFARSDELTRHYRKHTGAKPFKCNHCDRCFSRSDHLALHMKRHI
Background
Function FUNCTION: Transcriptional factor (PubMed:9774444, PubMed:16339272). Plays a critical role in neuronal morphogenesis and survival of sensory neurons (By similarity). Represses the corneal epithelium differentiation (PubMed:28916725). Acts also as a metabolic regulator, by modulating insulin sensitivity in pancreatic beta cells and skeletal muscle cells (PubMed:16339272). Inhibits transcriptional inducers of adipogenesis and has a repressive role in the expression of several adipokines, including leptin (PubMed:16339272). {ECO:0000250|UniProtKB:Q99JB0, ECO:0000269|PubMed:16339272, ECO:0000269|PubMed:28916725, ECO:0000269|PubMed:9774444}.
Pathway
Protein Families Krueppel C2H2-type zinc-finger protein family
Tissue Specificity Widely expressed. {ECO:0000269|PubMed:16339272, ECO:0000269|PubMed:9774444}.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8694225

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human KLF7 protein
Copyright © 2021-present Echo Biosystems. All rights reserved.