Recombinant Human Kita-kyushu lung cancer antigen 1 (CT83)-VLPs

Specification
Uniprot ID Q5H943
Gene Names CT83
Alternative Names (KK-LC-1)(Cancer/testis antigen 83)
Organism Homo sapiens (Human)
Expression Host Mammalian cell
Tag Info N-terminal 6xHis-tagged (This tag can be tested only under denaturing conditions)
Molecular Weight 14 kDa
Expression Region Full Length(1-113aa )
Expression Region N-terminal 6xHis-tagged (This tag can be tested only under denaturing conditions)(Full Length )
Purity The purity information is not available for VLPs proteins.
Endotoxin Less than 1.0 EU/ug as determined by LAL method.
Form Lyophilized powder
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Storage Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Protein Sequence MNFYLLLASSILCALIVFWKYRRFQRNTGEMSSNSTALALVRPSSSGLINSNTDNNLAVYDLSRDILNNFPHSIARQKRILVNLSMVENKLVELEHTLLSKGFRGASPHRKST
Background
Research Areas Cancer
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$693.00
In stock
SKU
EB-M3HU2133279

Recombinant Human Kita-kyushu lung cancer antigen 1 (CT83)-VLPs

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human Kita-kyushu lung cancer antigen 1 (CT83)-VLPs
Copyright © 2026-present Echo Bio. All rights reserved.