Specification
| Organism | Homo sapiens (Human) |
| Expression Host | Mammalian cell |
| Protein Tag | N-terminal 6xHis-tagged(This tag can be tested only under denaturing conditions) |
| Purity | Testing in progress. |
| Endotoxin Level | Less than 1.0 EU/ug as determined by LAL method. |
| Biological Activity | |
| Uniprot ID | Q5H943 |
| Gene Names | CT83 |
| Alternative Names | (KK-LC-1)(Cancer/testis antigen 83) |
| Expression Region | 1-113aa |
| Product Form | Lyophilized powder |
| Buffer | Lyophilized from a 0.2 um filtered PBS, 6% Trehalose, pH 7.28 |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-1520℃. |
| Protein Length | Full Length |
| Molecular Weight | 14 kDa |
| Protein Sequence | MNFYLLLASSILCALIVFWKYRRFQRNTGEMSSNSTALALVRPSSSGLINSNTDNNLAVYDLSRDILNNFPHSIARQKRILVNLSMVENKLVELEHTLLSKGFRGASPHRKST |
Background
| Research Areas | Cancer |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |