Recombinant Human Kita-kyushu lung cancer antigen 1(CT83)-VLPs (Active)

Specification
Organism Homo sapiens (Human)
Expression Host Mammalian cell
Protein Tag N-terminal 6xHis-tagged(This tag can be tested only under denaturing conditions)
Purity Testing in progress.
Endotoxin Level Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
Uniprot ID Q5H943
Gene Names CT83
Alternative Names (KK-LC-1)(Cancer/testis antigen 83)
Expression Region 1-113aa
Product Form Lyophilized powder
Buffer Lyophilized from a 0.2 um filtered PBS, 6% Trehalose, pH 7.28
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-1520℃.
Protein Length Full Length
Molecular Weight 14 kDa
Protein Sequence MNFYLLLASSILCALIVFWKYRRFQRNTGEMSSNSTALALVRPSSSGLINSNTDNNLAVYDLSRDILNNFPHSIARQKRILVNLSMVENKLVELEHTLLSKGFRGASPHRKST
Background
Research Areas Cancer
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$614.00
In stock
SKU
EB-N232441

Protein expressed from mulitple host is available with various size. Please inquiry us if you need any customized needs.

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human Kita-kyushu lung cancer antigen 1(CT83)-VLPs (Active)
Copyright © 2026-present Echo Bio. All rights reserved.