Specification
Organism | Homo sapiens (Human) |
Expression Host | Mammalian cell |
Tag Info | C-terminal 6xHis-tagged |
Purity | Greater than 95% as determined by SDS-PAGE. |
Uniprot ID | P21583 |
Uniprot Entry Name | |
Gene Names | KITLG |
Alternative Names | Kit Ligand; Mast Cell Growth Factor; MGF; Stem Cell Factor; SCF; c-Kit ligand; KITLG; MGF; SCF |
Expression Region | Partial (26-214aa) |
Molecular Weight | 22 kDa |
Endotoxin | Less than 1.0 EU/µg as determined by LAL method. |
Sequence | EGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKAKNPPGDSSLH |
Product Form | Lyophilized powder (Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4) |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
Relevance | Stem Cell Factor (SCF) is a hematopoietic growth factor that exerts its activity at the early stages of hematopoiesis. SCF stimulates the proliferation of myeloid, erythroid, and lymphoid progenitors in bone marrow cultures and has been shown to act synergistically with colony stimulating factors. |
Function | Ligand for the receptor-type protein-tyrosine kinase KIT. Plays an essential role in the regulation of cell survival and proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration and function, and in melanogenesis. KITLG/SCF binding can activate several signaling pathways. Promotes phosphorylation of PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase, and subsequent activation of the kinase AKT1. KITLG/SCF and KIT also transmit signals via GRB2 and activation of RAS, RAF1 and the MAP kinases MAPK1/ERK2 and/or MAPK3/ERK1. KITLG/SCF and KIT promote activation of STAT family members STAT1, STAT3 and STAT5. KITLG/SCF and KIT promote activation of PLCG1, leading to the production of the cellular signaling molecules diacylglycerol and inositol 1,4,5-trisphosphate. KITLG/SCF acts synergistically with other cytokines, probably interleukins. |
Involvement in disease | Hyperpigmentation with or without hypopigmentation, familial progressive (FPHH); Deafness, congenital, unilateral or asymmetric (DCUA) |
Subcellular Location | Isoform 1: Cell membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Isoform 2: Cytoplasm, Cytoplasm, cytoskeleton, Cell membrane, Single-pass type I membrane protein, Cell projection, lamellipodium, Cell projection, filopodium, SUBCELLULAR LOCATION: Soluble KIT ligand: Secreted |
Protein Families | SCF family |
Tissue Specificity | |
Pathway | MAPKsignalingpathway |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |