Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q8IVT5 |
| Gene Names | KSR1 |
| Alternative Names | KSR |
| Expression Region | Partial(404-598aa ) |
| Molecular Weight | 25.0 kDa |
| Protein Sequence | TESVPSDINNPVDRAAEPHFGTLPKALTKKEHPPAMNHLDSSSNPSSTTSSTPSSPAPFPTSSNPSSATTPPNPSPGQRDSRFNFPAAYFIHHRQQFIFPVPSAGHCWKCLLIAESLKENAFNISAFAHAAPLPEAADGTRLDDQPKADVLEAHEAEAEEPEAGKSEAEDDEDEVDDLPSSRRPWRGPISRKASQ |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Scaffolding protein that is part of a multiprotein signaling complex. Promotes phosphorylation of Raf family members and activation of downstream MAP kinases. Promotes activation of MAPK1 and/or MAPK3, both in response to EGF and to cAMP. Does not have kinase activity by itself. |
| Involvement in Disease | |
| Subcellular Location | Cytoplasm, Membrane, Peripheral membrane protein, Cell membrane, Peripheral membrane protein, Cell projection, ruffle membrane, Endoplasmic reticulum membrane |
| Protein Families | Protein kinase superfamily, TKL Ser/Thr protein kinase family |
| Tissue Specificity | KSR1 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |