Recombinant Human Killer cell immunoglobulin-like receptor 2DS3(KIR2DS3),partial

Specification
Organism Homo sapiens (Human)
Expression Host Yeast
Tag Info N-terminal 6xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID Q14952
Gene Names KIR2DS3
Alternative Names MHC class I NK cell receptor Natural killer-associated transcript 7 NKAT7
Expression Region Partial(22-245aa )
Molecular Weight 26.7 kDa
Protein Sequence HEGFRRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLLHREGTFNDTLRLIGEHIDGVSKANFSIGRMRQDLAGTYRCYGSVPHSPYQFSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSWSSYDMYHLSTEGEAHERRFSAGPKVNGTFQADFPLGPATQGGTYRCFGSFHDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSKTGNPRHLH
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Receptor on natural killer (NK) cells for HLA-C alleles. Does not inhibit the activity of NK cells.
Involvement in Disease
Subcellular Location Cell membrane, Single-pass type I membrane protein
Protein Families Immunoglobulin superfamily
Tissue Specificity KIR2DS3
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$275.00
In stock
SKU
EB-PY0HU613655

Recombinant Human Killer cell immunoglobulin-like receptor 2DS3(KIR2DS3),partial

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human Killer cell immunoglobulin-like receptor 2DS3(KIR2DS3),partial
Copyright © 2021-present Echo Biosystems. All rights reserved.