Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Protein Tag | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Endotoxin Level | Not test. |
| Biological Activity | |
| Uniprot ID | Q8N109 |
| Gene Names | KIR2DL5A |
| Alternative Names | (CD antigen CD158f1) |
| Expression Region | 22-238aa |
| Product Form | Liquid or Lyophilized powder |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.26 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-118℃. |
| Protein Length | Partial |
| Molecular Weight | 30.7 kDa |
| Protein Sequence | HEGGQDKPLLSAWPSAVVPRGGHVTLLCRSRLGFTIFSLYKEDGVPVPELYNKIFWKSILMGPVTPAHAGTYRCRGSHPRSPIEWSAPSNPLVIVVTGLFGKPSLSAQPGPTVRTGENVTLSCSSRSSFDMYHLSREGRAHEPRLPAVPSVNGTFQADFPLGPATHGGTYTCFGSLHDSPYEWSDPSDPLLVSVTGNSSSSSSSPTEPSSKTGIRRH |
Background
| Research Areas | Others |
| Relevance | Receptor on natural killer (NK) cells for HLA-C alleles. Inhibits the activity of NK cells thus preventing cell lysis. |
| Function | |
| Reference | "Activating killer cell immunoglobulin-like receptors 3DS1 and 2DS1 protect against developing the severe form of recurrent respiratory papillomatosis." Bonagura V.R., Du Z., Ashouri E., Luo L., Hatam L.J., DeVoti J.A., Rosenthal D.W., Steinberg B.M., Abramson A.L., Gjertson D.W., Reed E.F., Rajalingam R. Hum Immunol 71:212-219(2010) |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |