Recombinant Human KCNK17 protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens potassium two pore domain channel subfamily K member 17 (KCNK17), transcript variant 1 (NM_031460).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q96T54
Entry Name KCNKH_HUMAN
Gene Names KCNK17 TALK2 TASK4 UNQ5816/PRO19634
Alternative Gene Names TALK2 TASK4
Alternative Protein Names Potassium channel subfamily K member 17 (2P domain potassium channel Talk-2) (Acid-sensitive potassium channel protein TASK-4) (TWIK-related acid-sensitive K(+) channel 4) (TWIK-related alkaline pH-activated K(+) channel 2) (TALK-2)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 332
Molecular Weight(Da) 36895
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MYRPRARAAPEGRVRGCAVPSTVLLLLAYLAYLALGTGVFWTLEGRAAQDSSRSFQRDKWELLQNFTCLDRPALDSLIRDVVQAYKNGASLLSNTTSMGRWELVGSFFFSVSTITTIGYGNLSPNTMAARLFCIFFALVGIPLNLVVLNRLGHLMQQGVNHWASRLGGTWQDPDKARWLAGSGALLSGLLLFLLLPPLLFSHMEGWSYTEGFYFAFITLSTVGFGDYVIGMNPSQRYPLWYKNMVSLWILFGMAWLALIIKLILSQLETPGRVCSCCHHSSKEDFKSQSWRQGPDREPESHSPQQGCYPEGPMGIIQHLEPSAHAAGCGKDS
Background
Function FUNCTION: Outward rectifying potassium channel. Produces rapidly activating and non-inactivating outward rectifier K(+) currents.
Pathway
Protein Families Two pore domain potassium channel (TC 1.A.1.8) family
Tissue Specificity
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$389.00
In stock
SKU
EB-EPE8479166

Recombinant Human KCNK17 protein

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human KCNK17 protein
Copyright © 2021-present Echo Biosystems. All rights reserved.