Recombinant Human KAAG1 protein

Specification
Description Recombinant protein from the full-length sequence of homo sapiens kidney associated antigen 1 (KAAG1) (NM_181337).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q9UBP8
Entry Name KAAG1_HUMAN
Gene Names KAAG1 RU2AS
Alternative Gene Names RU2AS
Alternative Protein Names Kidney-associated antigen 1 (RU2 antisense gene protein)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 84
Molecular Weight(Da) 8969
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MDDDAAPRVEGVPVAVHKHALHDGLRQVAGPGAAAAHLPRWPPPQLAASRREAPPLSQRPHRTQGAGSPPETNEKLTNPQVKEK
Background
Function
Pathway
Protein Families
Tissue Specificity Expressed in testis and kidney, and, at lower levels, in urinary bladder and liver. Expressed by a high proportion of tumors of various histologic origin, including melanomas, sarcomas and colorectal carcinomas. {ECO:0000269|PubMed:10601354}.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8110565

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human KAAG1 protein
Copyright © 2021-present Echo Biosystems. All rights reserved.