Recombinant Human JPT2 protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens Jupiter microtubule associated homolog 2 (JPT2) (NM_144570).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q9H910
Entry Name JUPI2_HUMAN
Gene Names JPT2 C16orf34 HN1L L11
Alternative Gene Names C16orf34 HN1L
Alternative Protein Names Jupiter microtubule associated homolog 2 (Hematological and neurological expressed 1-like protein) (HN1-like protein)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 190
Molecular Weight(Da) 20063
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MFQVPDSEGGRAGSRAMKPPGGESSNLFGSPEEATPSSRPNRMASNIFGPTEEPQNIPKRTNPPGGKGSGIFDESTPVQTRQHLNPPGGKTSDIFGSPVTATSRLAHPNKPKDHVFLCEGEEPKSDLKAARSIPAGAEPGEKGSARKAGPAKEQEPMPTVDSHEPRLGPRPRSHNKVLNPPGGKSSISFY
Background
Function
Pathway
Protein Families JUPITER family
Tissue Specificity Expressed in liver, kidney, prostate, testis and uterus. {ECO:0000269|PubMed:15094197}.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8564175

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human JPT2 protein
Copyright © 2021-present Echo Biosystems. All rights reserved.