Specification
Organism | Homo sapiens (Human) |
Expression Host | Mammalian cell |
Protein Tag | N-terminal 10xHis-tagged |
Purity | Greater than 95% as determined by SDS-PAGE. |
Endotoxin Level | Less than 1.0 EU/ug as determined by LAL method. |
Biological Activity | Unit Definition: One unit is defined as the amount of enzyme required to cleave 1 nmol p-nitro-phenylphosphate (pNPP), in 1 minute at 37, pH10.0. The specific activity is > 8836.463 U/mg. |
Uniprot ID | P09923 |
Gene Names | ALPI |
Alternative Names | (IAP)(Intestinal alkaline phosphatase) |
Expression Region | 20-503aa |
Product Form | Lyophilized powder |
Buffer | Lyophilized from a 0.2 um filtered PBS, 6% Trehalose, pH 7.11 |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-372℃. |
Protein Length | Full Length of Mature Protein |
Molecular Weight | 55.2 kDa |
Protein Sequence | VIPAEEENPAFWNRQAAEALDAAKKLQPIQKVAKNLILFLGDGLGVPTVTATRILKGQKNGKLGPETPLAMDRFPYLALSKTYNVDRQVPDSAATATAYLCGVKANFQTIGLSAAARFNQCNTTRGNEVISVMNRAKQAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDADMPASARQEGCQDIATQLISNMDIDVILGGGRKYMFPMGTPDPEYPADASQNGIRLDGKNLVQEWLAKHQGAWYVWNRTELMQASLDQSVTHLMGLFEPGDTKYEIHRDPTLDPSLMEMTEAALRLLSRNPRGFYLFVEGGRIDHGHHEGVAYQALTEAVMFDDAIERAGQLTSEEDTLTLVTADHSHVFSFGGYTLRGSSIFGLAPSKAQDSKAYTSILYGNGPGYVFNSGVRPDVNESESGSPDYQQQAAVPLSSETHGGEDVAVFARGPQAHLVHGVQEQSFVAHVMAFAACLEPYTACDLAPPACTTD |
Background
Research Areas | Signal Transduction |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |