Specification
Organism | Homo sapiens (Human) |
Expression Host | E.coli |
Protein Tag | C-terminal 6xHis-tagged |
Purity | Greater than 85% as determined by SDS-PAGE. |
Endotoxin Level | Not test. |
Biological Activity | |
Uniprot ID | P03956 |
Gene Names | MMP1 |
Alternative Names | Fibroblast collagenase;Matrix metalloproteinase-1 ;MMP-1 |
Expression Region | 270-469aa |
Product Form | Liquid or Lyophilized powder |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.447 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-561℃. |
Protein Length | Partial |
Molecular Weight | 24.6 kDa |
Protein Sequence | IGPQTPKACDSKLTFDAITTIRGEVMFFKDRFYMRTNPFYPEVELNFISVFWPQLPNGLEAAYEFADRDEVRFFKGNKYWAVQGQNVLHGYPKDIYSSFGFPRTVKHIDAALSEENTGKTYFFVANKYWRYDEYKRSMDPGYPKMIAHDFPGIGHKVDAVFMKDGFFYFFHGTRQYKFDPKTKRILTLQKANSWFNCRKN |
Background
Research Areas | Developmental Biology |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |