Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P10145 |
| Gene Names | CXCL8 |
| Alternative Names | C-X-C motif chemokine hemokine (C-X-C motif) ligand 8Emoctakin;Granulocyte chemotactic protein 1 ;GCP-1Monocyte-derived neutrophil chemotactic factor ;MDNCFMonocyte-derived neutrophil-activating peptide ;MONAPNeutrophil-activating protein 1 ;NAP-1;Protein 3-10CT-cell chemotactic factor |
| Expression Region | Partial(23-99aa ) |
| Molecular Weight | 13.0 kDa |
| Protein Sequence | AVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | IL-8 is a chotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus. IL-8(6-77) has a 5-10-fold higher activity on neutrophil activation, IL-8(5-77) has increased activity on neutrophil activation and IL-8(7-77) has a higher affinity to receptors CXCR1 and CXCR2 as compared to IL-8(1-77), respectively. |
| Involvement in Disease | |
| Subcellular Location | Secreted |
| Protein Families | Intercrine alpha (chemokine CxC) family |
| Tissue Specificity | CXCL8 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |