Specification
Organism | Homo sapiens (Human) |
Expression Host | in vitro E.coli expression system |
Tag Info | N-terminal 6xHis-SUMO-tagged |
Purity | Greater than 85% by SDS-PAGE |
Uniprot ID | P13232 |
Gene Names | IL7 |
Alternative Names | IL 7; IL-7; Il7; IL7_HUMAN; Interleukin 7; Interleukin-7; LP-1; Lymphopoietin 1 |
Expression Region | Full Length of Mature Protein(26-177aa ) |
Molecular Weight | 33.4 kDa |
Protein Sequence | DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH |
Form | Liquid or Lyophilization |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
Relevance | Hematopoietic growth factor capable of stimulating the proliferation of lymphoid progenitors. It is important for proliferation during certain stages of B-cell maturation. |
Involvement in Disease | |
Subcellular Location | Secreted |
Protein Families | IL-7/IL-9 family |
Tissue Specificity | IL7 |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |