Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-SUMO-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q9UBH0 |
| Gene Names | IL36RN |
| Alternative Names | FIL1 deltaIL-1-related protein 3 ;IL-1RP3Interleukin-1 HY1 ;IL-1HY1Interleukin-1 delta ;IL-1 deltaInterleukin-1 family member 5 ;IL-1F5Interleukin-1 receptor antagonist homolog 1 ;IL-1ra homolog 1Interleukin-1-like protein 1 ;IL-1L1 |
| Expression Region | Full Length(1-155aa ) |
| Molecular Weight | 33 kDa |
| Protein Sequence | MVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAGKVIKGEEISVVPNRWLDASLSPVILGVQGGSQCLSCGVGQEPTLTLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTVPEADQPVRLTQLPENGGWNAPITDFYFQQCD |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Inhibits the activity of interleukin-36 (IL36A,IL36B and IL36G) by binding to receptor IL1RL2 and preventing its association with the coreceptor IL1RAP for signaling. Part of the IL-36 signaling syst that is thought to be present in epithelial barriers and to take part in local inflammatory response; similar to the IL-1 syst with which it shares the coreceptor. Proposed to play a role in skin inflammation. May be involved in the innate immune response to fungal pathogens, such as Aspergillus fumigatus. May activate an anti-inflammatory signaling pathway by recruiting SIGIRR. |
| Involvement in Disease | Psoriasis 14, pustular (PSORS14) |
| Subcellular Location | Secreted |
| Protein Families | IL-1 family |
| Tissue Specificity | IL36RN |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |