Specification
Organism | Homo sapiens (Human) |
Expression Host | E.coli |
Tag Info | C-terminal 6xHis-tagged |
Purity | Greater than 85% by SDS-PAGE |
Uniprot ID | P08700 |
Gene Names | IL3 |
Alternative Names | Hematopoietic growth factor Mast cell growth factor |
Expression Region | Full Length of Mature Protein(20-152aa ) |
Molecular Weight | 17.1 kDa |
Protein Sequence | APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF |
Form | Liquid or Lyophilization |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
Relevance | Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages. This CSF induces granulocytes, macrophages, mast cells, stem cells, erythroid cells, eosinophils and megakaryocytes. |
Involvement in Disease | |
Subcellular Location | Secreted |
Protein Families | IL-3 family |
Tissue Specificity | IL3 |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |