Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | Tag-Free |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Uniprot ID | Q9GZX6 |
| Uniprot Entry Name | |
| Gene Names | IL22 |
| Alternative Names | Interleukin-22;IL-22;Cytokine Zcyto18;IL-10-related T-cell-derived-inducible factor;IL-TIF; IL22;ILTIF; ZCYTO18 |
| Expression Region | Partial (34-179aa) |
| Molecular Weight | 16.9 kDa |
| Endotoxin | Less than 1.0 EU/µg as determined by LAL method. |
| Sequence | APISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI |
| Product Form | Lyophilized powder (Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4) |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Background
| Relevance | Interleukin-22(IL-22) is a member of a group of the IL-10 family, a class of potent mediators of cellular inflammatory responses. IL-22 is produced by activated DC and T cells. IL-22 and IL-10 receptor chains play a role in cellular targeting and signal transduction. It can initiate and regulate innate immune responses against bacterial pathogens especially in epithelial cells such as respiratory and gut epithelial cells. IL-22 along with IL-17 likely plays a role in the coordinated response of both adaptive and innate immune systems. IL-22 also promotes hepatocyte survival in the liver and epithelial cells in the lung and gut similar to IL-10. Biological activity of IL-22 is initiated by binding to a cell-surface complex consisting of IL-22R1 and IL-10R2 receptor chains. IL-22 biological activity is further regulated by interactions with a soluble binding protein, IL-22BP. IL-22BP and an extracellular region of IL-22R1 share sequence similarity. In some cases, the pro-inflammatory versus tissue-protective functions of IL-22 are regulated by cytokine IL-17A. |
| Function | Cytokine that contributes to the inflammatory response in vivo. |
| Involvement in disease | |
| Subcellular Location | Secreted |
| Protein Families | IL-10 family |
| Tissue Specificity | |
| Pathway | Jak-STATsignalingpathway |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |