Recombinant Human Interleukin-17A(IL17A)(T26A) (Active)

Specification
Organism Homo sapiens (Human)
Expression Host Baculovirus
Protein Tag N-terminal 6xHis-tagged
Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Level Less than 1.0 EU/ug as determined by LAL method.
Biological Activity Measured by its binding ability in a functional ELISA. Please contact us for the specific data.
Uniprot ID Q16552
Gene Names IL17A
Alternative Names (IL-17)(IL-17A)(Cytotoxic T-lymphocyte-associated antigen 8)(CTLA-8)
Expression Region 24-155aa(T26A)
Product Form Lyophilized powder
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.1388 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-1507℃.
Protein Length Full Length of Mature Protein
Molecular Weight 15.9 kDa
Protein Sequence GIAIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Background
Research Areas Immunology
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$343.00
In stock
SKU
EB-N232428

Protein expressed from mulitple host is available with various size. Please inquiry us if you need any customized needs.

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human Interleukin-17A(IL17A)(T26A) (Active)
Copyright © 2021-present Echo Biosystems. All rights reserved.