Recombinant Human Interleukin-13(IL13),partial(Active)

Specification
Organism Homo sapiens (Human)
Expression Host Mammalian cell
Tag Info C-terminal 6xHis-tagged
Purity Greater than 95% as determined by SDS-PAGE.
Uniprot ID P35225
Uniprot Entry Name
Gene Names IL13
Alternative Names Interleukin-13;IL-13;
Expression Region Partial (35-146aa)
Molecular Weight 14.3 kDa
Endotoxin Less than 1.0 EU/µg as determined by LAL method.
Sequence GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN
Product Form Lyophilized powder (Lyophilized from a 0.2 μm filtered solution of PBS,PH7.4.)
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Background
Relevance Interleukin-13 is also known as IL-13. It is a protein that in humans is encoded by the IL13 gene. Interleukin-13 is an immunoregulatory cytokine produced primarily by activated Th2 cells.It is involved in several stages of B-cell maturation and differentiation. It up-regulates CD23 and MHC class II expression, and promotes IgE isotype switching of B cells. This cytokine down-regulates macrophage activity, thereby inhibits the production of pro-inflammatory cytokines and chemokines. This cytokine is found to be critical to the pathogenesis of allergen-induced asthma but operates through mechanisms independent of IgE and eosinophils.
Function Cytokine
Involvement in disease Allergic rhinitis (ALRH)
Subcellular Location Secreted
Protein Families IL-4/IL-13 family
Tissue Specificity
Pathway Jak-STATsignalingpathway
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$261.00
In stock
SKU
EB-CAPHU4446

Recombinant Human Interleukin-13(IL13),partial(Active)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human Interleukin-13(IL13),partial(Active)
Copyright © 2026-present Echo Bio. All rights reserved.