Recombinant Human Interleukin-13(IL13)

Specification
Organism Homo sapiens (Human)
Expression Host Mammalian cell
Tag Info C-terminal hFc-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P35225
Gene Names IL13
Alternative Names /
Expression Region Full Length of Mature Protein(25-146aa )
Molecular Weight 42.2
Protein Sequence LTCLGGFASPGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance
Involvement in Disease
Subcellular Location
Protein Families
Tissue Specificity IL13
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$356.00
In stock
SKU
EB-PM0HU11715

Recombinant Human Interleukin-13(IL13)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human Interleukin-13(IL13)
Copyright © 2021-present Echo Biosystems. All rights reserved.